PDB entry 2avu

View 2avu on RCSB PDB site
Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription
Class: transcription activator
Keywords: C4-type Zinc finger
Deposited on 2005-08-30, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator flhD
    Species: Escherichia coli
    Gene: flhD, flbB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2avua1
  • Chain 'B':
    Compound: Transcriptional activator flhD
    Species: Escherichia coli
    Gene: flhD, flbB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2avub1
  • Chain 'C':
    Compound: Transcriptional activator flhD
    Species: Escherichia coli
    Gene: flhD, flbB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2avuc1
  • Chain 'D':
    Compound: Transcriptional activator flhD
    Species: Escherichia coli
    Gene: flhD, flbB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2avud1
  • Chain 'E':
    Compound: Flagellar transcriptional activator flhC
    Species: Escherichia coli
    Gene: flhC, flaI
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Flagellar transcriptional activator flhC
    Species: Escherichia coli
    Gene: flhC, flaI
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2avuA (A:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avuA (A:)
    tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
    lvchfrfdshqtitql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2avuB (B:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avuB (B:)
    tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
    lvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2avuC (C:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avuC (C:)
    tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
    lvchfrfdshqtitql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2avuD (D:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avuD (D:)
    tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
    lvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.