PDB entry 2avp

View 2avp on RCSB PDB site
Description: Crystal structure of an 8 repeat consensus TPR superhelix
Class: de novo protein
Keywords: tetratricopeptide repeat, TPR, consensus protein, superhelix
Deposited on 2005-08-30, released 2005-09-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synthetic consensus tpr protein
    Species: synthetic, synthetic
    Domains in SCOP 1.73: d2avpa1
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2avpA (A:)
gsaeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdydeaieyy
qkaleldprs

    Sequence, based on observed residues (ATOM records): (download) 
    >2avpA (A:)
aeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdydeaieyyqk
aleldprs