PDB entry 2avo
View 2avo on RCSB PDB site
Description: Kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, AND G73S
Class: hydrolase
Keywords: drug resistance; hiv-1 protease,indinavir, substrate analog,non-active site mutants., hydrolase
Deposited on
2005-08-30, released
2006-01-24
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.11
AEROSPACI score: 0.95
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- engineered (6)
- engineered (23)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.04: d2avoa_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- engineered (6)
- engineered (23)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.04: d2avob_ - Heterogens: SO4, MK1, DMS, ACY, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2avoA (A:)
pqitlwkrplvtikiggqlkealidtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2avoB (B:)
pqitlwkrplvtikiggqlkealidtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf