PDB entry 2avn

View 2avn on RCSB PDB site
Description: Crystal structure of Ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from THERMOTOGA MARITIMA at 2.35 A resolution
Class: structural genomics, unknown function
Keywords: tm1389, Ubiquinone/menaquinone biosynthesis methyltransferase-related protein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-08-30, released 2005-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.169
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquinone/menaquinone biosynthesis methyltransferase-related protein
    Species: Thermotoga maritima MSB8
    Gene: tm1389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1A9 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (30)
      • modified residue (87)
      • modified residue (161)
      • modified residue (215)
    Domains in SCOP 1.73: d2avna1
  • Chain 'B':
    Compound: ubiquinone/menaquinone biosynthesis methyltransferase-related protein
    Species: Thermotoga maritima MSB8
    Gene: tm1389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1A9 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (30)
      • modified residue (87)
      • modified residue (161)
      • modified residue (215)
    Domains in SCOP 1.73: d2avnb1
  • Heterogens: PO4, SAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2avnA (A:)
    mgsdkihhhhhhmklrswefydriaraydsmyetpkwklyhrligsfleeylknpcrvld
    lgggtgkwslflqergfevvlvdpskemlevarekgvknvveakaedlpfpsgafeavla
    lgdvlsyvenkdkafseirrvlvpdglliatvdnfytflqqmiekdawdqitrflktqtt
    svgttlfsfnsyafkpedldslegfetvdirgigvmeypderisereetifrleqelsrd
    rniiwkadhiffvlkkkrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avnA (A:)
    hmklrswefydriaraydsmyetpkwklyhrligsfleeylknpcrvldlgggtgkwslf
    lqergfevvlvdpskemlevarekgvknvveakaedlpfpsgafeavlalgdvlsyvenk
    dkafseirrvlvpdglliatvdnfytflqqmiekdawdqitrflktqttsvgttlfsfns
    yafkpedldslegfetvdirgigvmeypderisereetifrleqelsrdrniiwkadhif
    fvlkkkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2avnB (B:)
    mgsdkihhhhhhmklrswefydriaraydsmyetpkwklyhrligsfleeylknpcrvld
    lgggtgkwslflqergfevvlvdpskemlevarekgvknvveakaedlpfpsgafeavla
    lgdvlsyvenkdkafseirrvlvpdglliatvdnfytflqqmiekdawdqitrflktqtt
    svgttlfsfnsyafkpedldslegfetvdirgigvmeypderisereetifrleqelsrd
    rniiwkadhiffvlkkkrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avnB (B:)
    hmklrswefydriaraydsmyetpkwklyhrligsfleeylknpcrvldlgggtgkwslf
    lqergfevvlvdpskemlevarekgvknvveakaedlpfpsgafeavlalgdvlsyvenk
    dkafseirrvlvpdglliatvdnfytflqqmiekdawdqitrflktqttsvgttlfsfns
    yafkpedldslegfetvdirgigvmeypderisereetifrleqelsrdrniiwkadhif
    fvlkkkr