PDB entry 2avi

View 2avi on RCSB PDB site
Description: three-dimensional structures of avidin and the avidin-biotin complex
Class: biotin binding protein
Keywords: biotin binding protein
Deposited on 1993-04-23, released 1993-07-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.151
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.01: d2avia_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.01: d2avib_
  • Heterogens: NDG, BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aviA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aviA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aviB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aviB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l