PDB entry 2avi

View 2avi on RCSB PDB site
Description: three-dimensional structures of avidin and the avidin-biotin complex
Deposited on 1993-04-23, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.151
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2avia_
  • Chain 'B':
    Domains in SCOP 1.55: d2avib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aviA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aviB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l