PDB entry 2avg

View 2avg on RCSB PDB site
Description: NMR structure of cC1 domain from Human Cardiac Myosin Binding Protein C
Class: structural protein
Keywords: Human Cardiac MyBP-C, STRUCTURAL PROTEIN
Deposited on 2005-08-30, released 2006-09-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, cardiac-type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14896 (10-119)
      • see remark 999 (95)
    Domains in SCOPe 2.01: d2avga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2avgA (A:)
mhhhhhhssmddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdls
skvgqhlqlhdsydraskvylfelhitdaqpaftggyrcevstkdkfdcsnfnltvheam

    Sequence, based on observed residues (ATOM records): (download) 
    >2avgA (A:)
ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
dsydraskvylfelhitdaqpaftggyrcevstkdkfdcsnfnltvheam