PDB entry 2av9

View 2av9 on RCSB PDB site
Description: Crystal Structure of the PA5185 protein from Pseudomonas Aeruginosa Strain PAO1.
Class: hydrolase
Keywords: thioesterase, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2005-08-29, released 2005-10-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9a1
  • Chain 'B':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9b_
  • Chain 'C':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9c_
  • Chain 'D':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9d_
  • Chain 'E':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9e_
  • Chain 'F':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9f_
  • Chain 'G':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9g_
  • Chain 'H':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9h_
  • Chain 'I':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9i_
  • Chain 'J':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9j_
  • Chain 'K':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9k_
  • Chain 'L':
    Compound: thioesterase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04
      • modified residue (83)
    Domains in SCOPe 2.03: d2av9l_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2av9A (A:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9A (A:)
    prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
    vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
    ssrpvaipqelrdalaalqssa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2av9B (B:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9B (B:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2av9C (C:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9C (C:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalqs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2av9D (D:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9D (D:)
    taprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevi
    glvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfve
    rrssrpvaipqelrdalaalqs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2av9E (E:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9E (E:)
    plreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvv
    ssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrss
    rpvaipqelrdalaalq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2av9F (F:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9F (F:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalqs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2av9G (G:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9G (G:)
    lreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvvs
    sscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrssr
    pvaipqelrdalaalq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2av9H (H:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9H (H:)
    prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
    vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
    ssrpvaipqelrdalaalq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2av9I (I:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9I (I:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalqs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2av9J (J:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9J (J:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2av9K (K:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9K (K:)
    plreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvv
    ssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrss
    rpvaipqelrdalaalq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2av9L (L:)
    mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
    viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
    verrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av9L (L:)
    plreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvv
    ssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrss
    rpvaipqelrdalaalq