PDB entry 2av4

View 2av4 on RCSB PDB site
Description: Crystal structure of Plasmodium yoelii thioredoxin-like protein 4A (DIM1)
Class: structural genomics, unknown function
Keywords: thioredoxin-like protein, DIM1, U5 snRNP-specific 15kD protein, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2005-08-29, released 2005-09-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.21
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-like protein 4A (DIM1)
    Species: Plasmodium yoelii [TaxId:5861]
    Gene: PY07357
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7R866
      • expression tag (4-5)
    Domains in SCOPe 2.01: d2av4a1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2av4A (A:)
    mgsshhhhhhssglvprgssfmlqhlnsgwavdqaivnederlvcirfghdydpdcmkmd
    ellykvaddiknfcviylvditevpdfntmyelydpvsvmffyrnkhmmidlgtgnnnki
    nwpmnnkqefidivetifrgarkgrglvispkdystkyky
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av4A (A:)
    hhmlqhlnsgwavdqaivnederlvcirfghdydpdcmkmdellykvaddiknfcviylv
    ditevpdfntmyelydpvsvmffyrnkhmmidlgtgnnnkinwpmnnkqefidivetifr
    garkgrglvispkdy