PDB entry 2av3

View 2av3 on RCSB PDB site
Description: F97L- no ligand
Class: oxygen storage/transport
Keywords: Allosteric, oxygen binding, oxygen transport, hemoglobin, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2005-08-29, released 2006-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin I
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered (96)
    Domains in SCOPe 2.06: d2av3a_
  • Chain 'B':
    Compound: Globin I
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered (96)
    Domains in SCOPe 2.06: d2av3b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2av3A (A:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av3A (A:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2av3B (B:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2av3B (B:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal