PDB entry 2auu

View 2auu on RCSB PDB site
Description: Inorganic pyrophosphatase complexed with magnesium pyrophosphate and fluoride
Class: hydrolase
Keywords: inorganic pyrophosphatase, magnesium pyrophosphate, fluoride, HYDROLASE
Deposited on 2005-08-29, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7A9 (0-174)
      • see remark 999 (84)
    Domains in SCOPe 2.07: d2auua_
  • Heterogens: MG, NA, CL, F, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2auuA (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk