PDB entry 2aut

View 2aut on RCSB PDB site
Description: Crystal structure of Lys154Asn mutant of mature AphA of S. typhimurium
Class: hydrolase
Keywords: Class-B bacterial non-specific acid phosphatase, Lys154Asn mutant of mature AphA, metalloenzyme, Hydrolase
Deposited on 2005-08-29, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AphA
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d2auta_
  • Chain 'B':
    Compound: AphA
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d2autb_
  • Chain 'C':
    Compound: AphA
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d2autc_
  • Chain 'D':
    Compound: AphA
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d2autd_
  • Heterogens: MG, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2autA (A:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2autA (A:)
    tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
    pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
    tladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardcgirgir
    ilraanstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2autB (B:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2autB (B:)
    stlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkty
    spdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvs
    ktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardcgirgi
    rilraanstykplpqagafgeevivnsey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2autC (C:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2autC (C:)
    stlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkty
    spdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvs
    ktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardcgirgi
    rilraanstykplpqagafgeevivnsey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2autD (D:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2autD (D:)
    pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
    yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
    sktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardcgirg
    irilraanstykplpqagafgeevivnsey