PDB entry 2aun

View 2aun on RCSB PDB site
Description: Active site His285Ala mutant of LD-carboxypeptidase
Class: hydrolase
Keywords: LD-carboxypeptidase, peptidoglycan hydrolase, serine peptidase, serine-histidine-glutamate triad, nucleophilic elbow, Hydrolase
Deposited on 2005-08-28, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-316)
      • variant (39)
      • variant (113)
      • engineered (294)
    Domains in SCOPe 2.07: d2auna1, d2auna2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-316)
      • variant (39)
      • variant (113)
      • engineered (294)
    Domains in SCOPe 2.07: d2aunb1, d2aunb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aunA (A:)
    mghhhhhhefmtsrpssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgr
    hvearyrylagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprp
    ligfsdisvllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidh
    elpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlersl
    wqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsgagaqnr
    awpygktavlegnrlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aunA (A:)
    pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve
    qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsaf
    hrhglpaihgpvatglglqerlaslasvsrllagidhelpvqhlgghkqrvegaliggnl
    talacmagtlgglhapagsilvledvgepyyrlerslwqllesidarqlgaiclgsftdc
    prkevahslerifgeyaaaievplyhhlpsgagaqnrawpygktavlegnrlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aunB (B:)
    mghhhhhhefmtsrpssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgr
    hvearyrylagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprp
    ligfsdisvllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidh
    elpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlersl
    wqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsgagaqnr
    awpygktavlegnrlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aunB (B:)
    sdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtveqr
    ledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsafhr
    hglpaihgpvatglgleqqerlaslasvsrllagidhelpvqhlgghkqrvegaliggnl
    talacmagtlgglhapagsilvledvgepyyrlerslwqllesidarqlgaiclgsftdc
    prkevahslerifgeyaaaievplyhhlpsgagaqnrawpygktavlegnrlrw