PDB entry 2aum

View 2aum on RCSB PDB site
Description: Active site Ser115Ala mutant of LD-carboxypeptidase
Class: Hydrolase
Keywords: LD-carboxypeptidase, peptidoglycan hydrolase, serine peptidase, serine-histidine-glutamate triad, nucleophilic elbow
Deposited on 2005-08-28, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.242
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-316)
      • variant (39)
      • variant (113)
      • engineered (124)
    Domains in SCOPe 2.06: d2auma1, d2auma2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-316)
      • variant (39)
      • variant (113)
      • engineered (124)
    Domains in SCOPe 2.06: d2aumb1, d2aumb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aumA (A:)
    mghhhhhhefmtsrpssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgr
    hvearyrylagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprp
    ligfadisvllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidh
    elpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlersl
    wqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnr
    awpygktavlegnrlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aumA (A:)
    pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve
    qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfadisvllsaf
    hrhglpaihgpvatglglqerlaslasvsrllagidhelpvqhlgghkqrvegaliggnl
    talacmagtlgglhapagsilvledvgepyyrlerslwqllesidarqlgaiclgsftdc
    prkevahslerifgeyaaaievplyhhlpsghgaqnrawpygktavlegnrlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aumB (B:)
    mghhhhhhefmtsrpssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgr
    hvearyrylagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprp
    ligfadisvllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidh
    elpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlersl
    wqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnr
    awpygktavlegnrlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aumB (B:)
    sdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtveqr
    ledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfadisvllsafhr
    hglpaihgpvatglgleqqerlaslasvsrllagidhelpvqhlgghkqrvegaliggnl
    talacmagtlgglhapagsilvledvgepyyrlerslwqllesidarqlgaiclgsftdc
    prkevahslerifgeyaaaievplyhhlpsghgaqnrawpygktavlegnrlrw