PDB entry 2auh

View 2auh on RCSB PDB site
Description: Crystal structure of the Grb14 BPS region in complex with the insulin receptor tyrosine kinase
Class: transferase/signaling protein
Keywords: tyrosine kinase, BPS region, TRANSFERASE/SIGNALING PROTEIN COMPLEX
Deposited on 2005-08-27, released 2005-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.223
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • modified residue (180)
      • modified residue (184-185)
      • variant (273)
    Domains in SCOPe 2.06: d2auha1
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 14
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB14
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2auhA (A:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2auhA (A:)
    yvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerie
    flneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrpp
    ptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyy
    rkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvm
    dggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'B':
    No sequence available.