PDB entry 2au9

View 2au9 on RCSB PDB site
Description: Inorganic pyrophosphatase complexed with substrate
Class: hydrolase
Keywords: hydrolase, substrate complex, inorganic pyrophosphatase
Deposited on 2005-08-27, released 2006-08-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.149
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7A9 (0-174)
      • see remark 999 (84)
    Domains in SCOP 1.73: d2au9a1
  • Heterogens: MN, NA, CL, F, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2au9A (A:)
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk