PDB entry 2au6

View 2au6 on RCSB PDB site
Description: Crystal structure of catalytic intermediate of inorganic pyrophosphatase
Class: hydrolase
Keywords: hydrolase, intermediate, inorganic pyrophosphatase
Deposited on 2005-08-27, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.125
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: inorganic pyrophosphatase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7A9 (0-174)
    • see remark 999 (84)
  Domains in SCOPe 2.06: d2au6a_
• Heterogens: PO4, MN, NA, CL, F, POP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2au6A (A:)
  sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
  tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
  kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk