PDB entry 2au5

View 2au5 on RCSB PDB site
Description: Structure of a conserved domain from locus EF2947 from Enterococcus faecalis V583
Class: structural genomics, unknown function
Keywords: Enterococcus faecalis, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-08-26, released 2005-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved domain protein
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: EF2947
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82ZV0 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (27)
      • modified residue (50)
      • modified residue (64)
      • modified residue (130)
    Domains in SCOPe 2.08: d2au5a1, d2au5a2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2au5A (A:)
snamlilstekepnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwlee
aaggmqgvivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkft
flllcsdefimyldsqpkf

    Sequence, based on observed residues (ATOM records): (download) 
    >2au5A (A:)
amlilspnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaaggmq
gvivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftflllcs
defimylds