PDB entry 2au0

View 2au0 on RCSB PDB site
Description: Unmodified preinsertion binary complex
Class: transferase/DNA
Keywords: DNA polymerase, Y-family, lesion bypass, binary complex, transferase-DNA COMPLEX
Deposited on 2005-08-26, released 2006-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.271
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dpo4 polymerase IV
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97W02
      • cloning artifact (8)
    Domains in SCOPe 2.08: d2au0a1, d2au0a2, d2au0a3
  • Chain 'B':
    Compound: Dpo4 polymerase IV
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97W02 (9-End)
      • cloning artifact (8)
    Domains in SCOPe 2.08: d2au0b1, d2au0b2, d2au0b3
  • Chain 'D':
    Compound: 5'-d(*gp*gp*tp*tp*gp*gp*ap*tp*gp*gp*tp*ap*(ddg))-3'
  • Chain 'E':
    Compound: 5'-d(*cp*tp*ap*ap*cp*g*cp*tp*ap*cp*cp*ap*tp*cp*cp*ap*ap*cp*c)-3'
  • Chain 'H':
    Compound: 5'-d(*gp*gp*tp*tp*gp*gp*ap*tp*gp*gp*tp*ap*(ddg))-3'
  • Chain 'J':
    Compound: 5'-d(*cp*tp*ap*ap*cp*g*cp*tp*ap*cp*cp*ap*tp*cp*cp*ap*ap*cp*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2au0A (A:)
    gshmgggggivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyeark
    fgvkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldis
    dkvrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevk
    rlireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislarde
    ynepirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavted
    ldivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2au0A (A:)
    givlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2au0B (B:)
    gshmgggggivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyeark
    fgvkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldis
    dkvrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevk
    rlireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislarde
    ynepirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavted
    ldivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2au0B (B:)
    givlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.