PDB entry 2atw

View 2atw on RCSB PDB site
Description: Structure of a Mycobacterium tuberculosis NusA-RNA complex
Class: transcription/RNA
Keywords: Protein-RNA complex, transcription/RNA COMPLEX
Deposited on 2005-08-26, released 2005-10-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation protein nusA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: nusA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2atwa1, d2atwa2, d2atwa3
  • Chain 'B':
    Compound: ribosomal RNA (5'- AGAACUCAAUAG -3')
    Species: synthetic, synthetic
    Gene:
  • Chain 'C':
    Compound: Transcription elongation protein nusA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: nusA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2atwc1, d2atwc2, d2atwc3
  • Chain 'D':
    Compound: ribosomal RNA (5'- AGAACUCAAUAG -3')
    Species: synthetic, synthetic
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2atwA (A:)
    gefstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlr
    cyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskiavrs
    nvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvsvid
    qtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsrgma
    hdrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2atwA (A:)
    fstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcy
    vvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskiavrsnv
    aglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvsvidqt
    araarvvvpdfqlslaigkegqnarlaarltgwridirgdapp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2atwC (C:)
    gefstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlr
    cyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskiavrs
    nvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvsvid
    qtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsrgma
    hdrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2atwC (C:)
    gefstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlr
    cyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskiavrs
    nvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvsvid
    qtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapp
    

  • Chain 'D':
    No sequence available.