PDB entry 2atr

View 2atr on RCSB PDB site
Description: Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae TIGR4
Class: structural genomics, unknown function
Keywords: MCSG, structural genomics, Streptococcus pneumoniae, acetyltransferase, GNAT family, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-08-25, released 2005-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.221
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase, GNAT family
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP0256
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97SR8 (0-End)
      • modified residue (0)
      • modified residue (32)
      • modified residue (87)
      • modified residue (117)
      • modified residue (130)
    Domains in SCOPe 2.08: d2atra1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2atrA (A:)
    mitikkqeivkledvlhlyqavgwtnythqtemleqalshslviylaldgdavvglirlv
    gdgfssvfvqdlivlpsyqrqgigsslmkealgnfkeayqvqlateeteknvgfyrsmgf
    eilstydctgmiwinrek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2atrA (A:)
    mitikkqeivkledvlhlyqavgwtnemleqalshslviylaldgdavvglirlvgdgfs
    svfvqdlivlpsyqrqgigsslmkealgnfkeayqvqlateeteknvgfyrsmgfeilst
    ydctgmiwinre