PDB entry 2ati

View 2ati on RCSB PDB site
Description: Glycogen Phosphorylase Inhibitors
Class: Transferase
Keywords: Glycogen Phosphorylase
Deposited on 2005-08-25, released 2006-08-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.232
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2atia1
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2atib1
  • Heterogens: GLC, IHU, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2atiA (A:)
    akpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvr
    dhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldie
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveead
    dwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvnt
    mrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklp
    wskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpk
    dvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfq
    nktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqe
    nklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvp
    rtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipat
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaa
    ldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeay
    vkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsnes
    nkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2atiA (A:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapdyiqavldrnlae
    nisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskftvfdafpdqvaiqlndt
    hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
    eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
    divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
    lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
    lhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgskl
    kviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvema
    eeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkd
    iinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikey
    aqniwnvepsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2atiB (B:)
    akpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvr
    dhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldie
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveead
    dwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvnt
    mrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklp
    wskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpk
    dvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfq
    nktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqe
    nklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvp
    rtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipat
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaa
    ldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeay
    vkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsnes
    nkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2atiB (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapdyiqavldrnlae
    nisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskftvfdafpdqvaiqlndt
    hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
    eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
    divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
    lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
    lhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgskl
    kviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvema
    eeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkd
    iinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikey
    aqniwnvepsd