PDB entry 2ate

View 2ate on RCSB PDB site
Description: Structure of the complex of PurE with NitroAIR
Class: lyase
Keywords: PurE, nitroAIR complex, LYASE
Deposited on 2005-08-24, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.152
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylaminoimidazole carboxylase catalytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: purE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG18 (Start-168)
      • modified residue (13)
      • modified residue (22)
      • modified residue (78)
      • modified residue (109)
    Domains in SCOPe 2.08: d2atea_
  • Heterogens: NIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ateA (A:)
    mssrnnparvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaee
    ngyqviiagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtla
    igkagaanaallaaqilathdkelhqrlndwrkaqtdevlenpdprgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ateA (A:)
    arvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvii
    agaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkagaa
    naallaaqilathdkelhqrlndwrkaqtdevlenpdprgaa