PDB entry 2atc

View 2atc on RCSB PDB site
Description: crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
Deposited on 1982-03-24, released 1982-12-07
The last revision prior to the SCOP 1.69 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.27
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2atcA (A:)
    anplyqshiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
    tsmhrlgasvvgfsdsantslgkkgqtlantisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrlnnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmtrvqkerldpseyabvkaqfl
    vranslgglhnakmnakvlhplprvdeiatdvdktphawyfqqagngifarqallalvln
    rdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2atcB (B:)
    mthndklqvaeikrgtvinhipaeigfkllslfkltetqdritiglnlpsgemgrkdlik
    ientflsedevdelalyapqatvnrindyevvgksrpslpernidvlvcpdsncishaep
    vsssfavrraddialkckycekefshnvvlan