PDB entry 2at8

View 2at8 on RCSB PDB site
Description: 0.96 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus Containing Fe(III) 2,4 Dimethyl Deuteroporphyrin IX Complexed With Nitric Oxide at pH 5.6
Class: transport protein
Keywords: Lipocalin, beta barrel, ferrous, heme analog, Fe(III) 2,4 Dimethyl Deuteroporphyrin IX, TRANSPORT PROTEIN
Deposited on 2005-08-24, released 2006-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.166
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOPe 2.05: d2at8x_
• Heterogens: PO4, FDD, NO, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2at8X (X:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk