PDB entry 2asw

View 2asw on RCSB PDB site
Description: The solution structure of the hamp domain of the hypothetical transmembrane receptor Af1503
Class: unknown function
Keywords: homodimer, parallel coiled-coil, complementary x-da packing, unknown function
Deposited on 2005-08-24, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein AF1503
  Species: Archaeoglobus fulgidus [TaxId:2234]
  Gene: Af1503
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28769 (2-55)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2aswa2, d2aswa3
• Chain 'B':
  Compound: hypothetical protein AF1503
  Species: Archaeoglobus fulgidus [TaxId:2234]
  Gene: Af1503
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28769 (2-55)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2aswb2, d2aswb3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aswA (A:)
  gsstitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aswB (B:)
  gsstitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame