PDB entry 2asv

View 2asv on RCSB PDB site
Description: X-Ray studies on protein complexes: Enzymatic catalysis in Crystals of E. coli Maltodextrin Phosphorylase (MalP)
Class: transferase
Keywords: maltopentaose, carbohydrate recognition, phosphorylase mechanism, ternary oligosaccharide complexes, diffusion of substrates in the crystal, catalysis in the crystal, Transferase
Deposited on 2005-08-24, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: EG10560
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (0-795)
      • engineered (260-262)
    Domains in SCOPe 2.07: d2asva_
  • Chain 'B':
    Compound: maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: EG10560
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (0-795)
      • engineered (260-262)
    Domains in SCOPe 2.07: d2asvb_
  • Heterogens: BGC, GLC, ASO, PO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2asvA (A:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2asvB (B:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr