PDB entry 2ast

View 2ast on RCSB PDB site
Description: Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
Class: ligase/ligase inhibitor
Keywords: SCF-substrate complex, LRR, CELL CYCLE, PROTEIN TURNOVER COMPLEX, LIGASE-LIGASE INHIBITOR complex
Deposited on 2005-08-24, released 2005-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-phase kinase-associated protein 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1A, EMC19, OCP2, SKP1, TCEB1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63208 (0-158)
      • engineered (0)
  • Chain 'B':
    Compound: S-phase kinase-associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP2, FBXL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2astb1, d2astb2
  • Chain 'C':
    Compound: Cyclin-dependent kinases regulatory subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CKS1, CKS1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2astc_
  • Chain 'D':
    Compound: Cyclin-dependent kinase inhibitor 1B
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2astB (B:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2astB (B:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2astC (C:)
    qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
    hillfrrpl
    

  • Chain 'D':
    No sequence available.