PDB entry 2ass

View 2ass on RCSB PDB site
Description: Crystal structure of the Skp1-Skp2-Cks1 complex
Class: cell cycle/ligase/protein turnover
Keywords: protein-protein complex, LRR, SCF
Deposited on 2005-08-24, released 2005-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.214
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-phase kinase-associated protein 1A
    Species: HOMO SAPIENS
    Gene: SKP1A, EMC19, OCP2, SKP1, TCEB1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63208 (0-158)
      • engineered (0)
  • Chain 'B':
    Compound: S-phase kinase-associated protein 2
    Species: HOMO SAPIENS
    Gene: SKP2, FBXL1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2assb1, d2assb2
  • Chain 'C':
    Compound: Cyclin-dependent kinases regulatory subunit 1
    Species: HOMO SAPIENS
    Gene: CKS1, CKS1B
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2assc1
  • Heterogens: PO4, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2assB (B:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2assB (B:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2assC (C:)
    qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
    hillfrrpl