PDB entry 2asr

View 2asr on RCSB PDB site
Description: the three-dimensional structure of the aspartate receptor from escherichia coli
Deposited on 1994-08-23, released 1994-11-01
The last revision prior to the SCOP 1.71 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d2asr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2asr_ (-)
ksfvvsnqlreqqgeltstwdlmlqtrinlsrsavrmmmdssnqqsnakvelldsarktl
aqaathykkfksmaplpemvatsrnidekyknyytaltelidyldygntgayfaqptqgm
qnamgerfaqyalsseklyrdi