PDB entry 2ase

View 2ase on RCSB PDB site
Description: NMR structure of the F28L mutant of Cdc42Hs
Class: signaling protein
Keywords: GTP binding protein, G-protein, cell signalling, SIGNALING PROTEIN
Deposited on 2005-08-23, released 2006-02-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cell division control protein 42 homolog
  Species: Homo sapiens [TaxId:9606]
  Gene: CDC42
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60953 (0-177)
    • engineered (27)
    • isoform (162)
  Domains in SCOPe 2.06: d2asea1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aseA (A:)
  mqtikcvvvgdgavgktcllisyttnklpseyvptvfdnyavtvmiggepytlglfdtag
  qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
  ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale