PDB entry 2as8

View 2as8 on RCSB PDB site
Description: Crystal structure of mature and fully active Der p 1 allergen
Class: Hydrolase
Keywords: cysteine proteinase fold
Deposited on 2005-08-23, released 2005-12-06
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major mite fecal allergen Der p 1
    Species: Dermatophagoides pteronyssinus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08176 (0-221)
      • engineered (51)
      • see remark 999 (123)
    Domains in SCOP 1.73: d2as8a1
  • Chain 'B':
    Compound: Major mite fecal allergen Der p 1
    Species: Dermatophagoides pteronyssinus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08176 (0-221)
      • engineered (51)
      • see remark 999 (123)
    Domains in SCOP 1.73: d2as8b1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2as8A (A:)
    tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq
    elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy
    ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna
    qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2as8B (B:)
    tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq
    elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy
    ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna
    qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil