PDB entry 2as0

View 2as0 on RCSB PDB site
Description: Crystal Structure of PH1915 (APC 5817): A Hypothetical RNA Methyltransferase
Class: transferase
Keywords: RNA methyltransferase, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-08-22, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1915
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1915
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59578 (0-395)
      • modified residue (0)
      • modified residue (18)
      • modified residue (60)
      • modified residue (100)
      • modified residue (129)
      • modified residue (141)
      • modified residue (192)
      • modified residue (268)
      • modified residue (279)
      • modified residue (343)
      • modified residue (347)
      • modified residue (361)
      • modified residue (376)
      • modified residue (394)
    Domains in SCOPe 2.08: d2as0a1, d2as0a2
  • Chain 'B':
    Compound: hypothetical protein PH1915
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1915
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59578 (0-395)
      • modified residue (0)
      • modified residue (18)
      • modified residue (60)
      • modified residue (100)
      • modified residue (129)
      • modified residue (141)
      • modified residue (192)
      • modified residue (268)
      • modified residue (279)
      • modified residue (343)
      • modified residue (347)
      • modified residue (361)
      • modified residue (376)
      • modified residue (394)
    Domains in SCOPe 2.08: d2as0b1, d2as0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2as0A (A:)
    marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsni
    mvrivtkdkdveinkdlfkrrikkaneyrkkvlkytnvyrmvygeadylpglivdrfndi
    aslqissagmerfkldvaeaimevepgietvfekntgrsrrreglpeiervllgkekyrt
    iiqegrakfivdmrgqktgffldqrenrlalekwvqpgdrvldvftytggfaihaaiaga
    devigidkspraietakenaklngvedrmkfivgsafeemeklqkkgekfdivvldppaf
    vqhekdlkaglrayfnvnfaglnlvkdggilvtcscsqhvdlqmfkdmiiaagakagkfl
    kmlepyrtqapdhpilmaskdteylkclflyvedmr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2as0B (B:)
    marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsni
    mvrivtkdkdveinkdlfkrrikkaneyrkkvlkytnvyrmvygeadylpglivdrfndi
    aslqissagmerfkldvaeaimevepgietvfekntgrsrrreglpeiervllgkekyrt
    iiqegrakfivdmrgqktgffldqrenrlalekwvqpgdrvldvftytggfaihaaiaga
    devigidkspraietakenaklngvedrmkfivgsafeemeklqkkgekfdivvldppaf
    vqhekdlkaglrayfnvnfaglnlvkdggilvtcscsqhvdlqmfkdmiiaagakagkfl
    kmlepyrtqapdhpilmaskdteylkclflyvedmr