PDB entry 2arz

View 2arz on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function from Pseudomonas aeruginosa
Class: unknown function
Keywords: hypothetical protein,structural genomics,MCSG, Pseudomonas aeruginosa, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-08-22, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA4388
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2arza1
  • Chain 'B':
    Compound: hypothetical protein PA4388
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW16 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2arzb2, d2arzb3
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2arzA (A:)
    ansmsveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqh
    thnlqadprcsmlvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyh
    rvhdfdfwvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiah
    yvelaglpahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwp
    tvepeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arzA (A:)
    sveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthnl
    qadprcsmlvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhd
    fdfwvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyvel
    aglpahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2arzB (B:)
    ansmsveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqh
    thnlqadprcsmlvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyh
    rvhdfdfwvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiah
    yvelaglpahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwp
    tvepeqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arzB (B:)
    ansmsveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqh
    thnlqadprcsmlvgeavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhdfdf
    wvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyvelagl
    pahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv