PDB entry 2arw

View 2arw on RCSB PDB site
Description: The solution structure of the membrane proximal cytokine receptor domain of the human interleukin-6 receptor
Class: cytokine
Keywords: fibronectin-type III like, CYTOKINE
Deposited on 2005-08-22, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-6 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08887 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2arwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2arwA (A:)
    mgilqpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmv
    kdlqhhcvihdawsglrhvvqlraqeefgqgewsewspeamgtpwtesrsppaenevstp
    mqaltt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arwA (A:)
    mgilqpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmv
    kdlqhhcvihdawsglrhvvqlraqeefgqgewsewspeamgt