PDB entry 2arr

View 2arr on RCSB PDB site
Description: Human plasminogen activator inhibitor-2.[loop (66-98) deletion mutant] complexed with peptide n-acetyl-teaaagmggvmtgr-oh
Class: hydrolase inhibitor/peptide
Keywords: SERPIN, PEPTIDE BINDING, inhibitor, hydrolase inhibitor-peptide complex
Deposited on 2005-08-21, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.187
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator inhibitor-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05120 (Start-381)
      • conflict (55)
      • conflict (186)
    Domains in SCOPe 2.07: d2arra_
  • Chain 'P':
    Compound: 14-mer from Plasminogen activator inhibitor-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05120 (0-13)
      • engineered (6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2arrA (A:)
    medlcvantlfalnlfkhlakasptqnlflspwsisstmamvymgsrgstedqmasvlqf
    nevgaaadkihssfrslssainastgnyllesvnklfgeksasfreeyirlcqkyyssep
    qavdflecaeearkkinswvktqtkgkipnllpegsvdgdtrmvlvnavyfkgkwktpfe
    kklnglfpfrvnsaqrtpvqmmylreklnigyiedlkaqilelpyagdvsmflllpdeia
    dvstglelleseitydklnkwtskdkmaedevevyipqfkleehyelrsilrsmgmedaf
    nkgranfsgmserndlflsevfhqamvdvneegteaaagtggvmtgrtghggpqfvadhp
    flflimhkitncilffgrfssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arrA (A:)
    dlcvantlfalnlfkhlakasptqnlflspwsisstmamvymgsrgstedqmasvlqfne
    vkihssfrslssainastgnyllesvnklfgeksasfreeyirlcqkyyssepqavdfle
    caeearkkinswvktqtkgkipnllpegsvdgdtrmvlvnavyfkgkwktpfekklfpfr
    vnsaqrtpvqmmylreklnigyiedlkaqilelpyagdvsmflllpdadvstglellese
    itydklnkwtskmaedevevyipqfkleehyelrsilrsmgmedafnkgranfsgmsern
    dlflsevfhqamvdvneegttgrtghggpqfvadhpflflimhkitncilffgrfssp
    

  • Chain 'P':
    No sequence available.