PDB entry 2ark

View 2ark on RCSB PDB site
Description: Structure of a flavodoxin from Aquifex aeolicus
Class: electron transport
Keywords: flavodoxin, Aquifex aeolicus, FMN, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-08-19, released 2005-10-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Aquifex aeolicus
    Gene: fldA, floX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67866 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (20)
      • modified residue (63)
      • modified residue (70)
      • modified residue (108)
      • modified residue (113)
      • modified residue (115)
    Domains in SCOP 1.73: d2arka1
  • Chain 'B':
    Compound: flavodoxin
    Species: Aquifex aeolicus
    Gene: fldA, floX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67866 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (20)
      • modified residue (63)
      • modified residue (70)
      • modified residue (108)
      • modified residue (113)
      • modified residue (115)
    Domains in SCOP 1.73: d2arkb1
  • Chain 'C':
    Compound: flavodoxin
    Species: Aquifex aeolicus
    Gene: fldA, floX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67866 (3-187)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (20)
      • modified residue (63)
      • modified residue (70)
      • modified residue (108)
      • modified residue (113)
      • modified residue (115)
    Domains in SCOP 1.73: d2arkc1
  • Chain 'D':
    Compound: flavodoxin
    Species: Aquifex aeolicus
    Gene: fldA, floX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67866 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (20)
      • modified residue (63)
      • modified residue (70)
      • modified residue (108)
      • modified residue (113)
      • modified residue (115)
    Domains in SCOP 1.73: d2arkd1
  • Chain 'E':
    Compound: flavodoxin
    Species: Aquifex aeolicus
    Gene: fldA, floX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67866 (3-187)
      • modified residue (3)
      • modified residue (20)
      • modified residue (63)
      • modified residue (70)
      • modified residue (108)
      • modified residue (113)
      • modified residue (115)
    Domains in SCOP 1.73: d2arke1
  • Chain 'F':
    Compound: flavodoxin
    Species: Aquifex aeolicus
    Gene: fldA, floX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67866 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (20)
      • modified residue (63)
      • modified residue (70)
      • modified residue (108)
      • modified residue (113)
      • modified residue (115)
    Domains in SCOP 1.73: d2arkf1
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2arkA (A:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arkA (A:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2arkB (B:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arkB (B:)
    namgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgsp
    tnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgfl
    vfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekirk
    dparfv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2arkC (C:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arkC (C:)
    amgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgspt
    nmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgflv
    fgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekirkd
    parfvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2arkD (D:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arkD (D:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2arkE (E:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arkE (E:)
    mgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgsptn
    mglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgflvf
    gvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekirkdp
    arfvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2arkF (F:)
    snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
    ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
    lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
    kdparfvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arkF (F:)
    amgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgspt
    nmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgflv
    fgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekirkd
    parfv