PDB entry 2arj

View 2arj on RCSB PDB site
Description: CD8alpha-alpha in complex with YTS 105.18 Fab
Class: Immune System
Keywords: Protein-protein complex, Antibody Fab, Immune system, Immunoglobulin domain
Deposited on 2005-08-19, released 2006-05-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.223
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YTS 105.18 antigen binding region Light chain
    Species: Rattus norvegicus
  • Chain 'B':
    Compound: YTS 105.18 antigen binding region Heavy chain
    Species: Rattus norvegicus
  • Chain 'H':
    Compound: YTS 105.18 antigen binding region Heavy chain
    Species: Rattus norvegicus
  • Chain 'L':
    Compound: YTS 105.18 antigen binding region Light chain
    Species: Rattus norvegicus
  • Chain 'Q':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: MUS MUSCULUS
    Gene: Cd8a, Lyt-2, Lyt2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2arjq1
  • Chain 'R':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: MUS MUSCULUS
    Gene: Cd8a, Lyt-2, Lyt2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2arjr1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download) 
    >2arjQ (Q:)
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kvn

    Sequence, based on observed residues (ATOM records): (download) 
    >2arjQ (Q:)
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

  • Chain 'R':
    Sequence, based on SEQRES records: (download) 
    >2arjR (R:)
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kvn

    Sequence, based on observed residues (ATOM records): (download) 
    >2arjR (R:)
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvn