PDB entry 2ara

View 2ara on RCSB PDB site
Description: apo form of escherichia coli regulatory protein arac
Class: transcription regulation
Keywords: transcription regulation, jelly-roll, carbohydrate binding, coiled-coil
Deposited on 1996-10-30, released 1997-05-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arac
    Species: Escherichia coli [TaxId:562]
    Gene: ARAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2araa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2araA (A:)
lvagltpieangyldffidrplgmkgyilnltirgqgvvknqgrefvcrpgdillfppge
ihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahqphfsdlfgqii
nagqgegrysellainlleqlllrrmeai