PDB entry 2ar6

View 2ar6 on RCSB PDB site
Description: Pterocarpus angolensis Lectin (PAL) In Complex With The Pentasaccharide M592
Class: sugar binding protein
Keywords: lectin, carbohydrate recognition, sugar binding protein
Deposited on 2005-08-19, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pterocarpus angolensis [TaxId:182271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ar6a_
  • Chain 'B':
    Compound: lectin
    Species: Pterocarpus angolensis [TaxId:182271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ar6b_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ar6A (A:)
    qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar6A (A:)
    qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ar6B (B:)
    qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar6B (B:)
    qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt