PDB entry 2ar5

View 2ar5 on RCSB PDB site
Description: Crystal structure of the mammalian C2alpha-PI3 Kinase PX-domain
Class: transferase
Keywords: PX domain, TRANSFERASE
Deposited on 2005-08-19, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoinositide 3-kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PI3KC2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14CQ9 (1-112)
      • cloning artifact (0)
      • cloning artifact (113-114)
      • expression tag (115-116)
    Domains in SCOPe 2.08: d2ar5a1, d2ar5a2, d2ar5a3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ar5A (A:)
mdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfdefqelhnklsiifpl
wklpgfpnrmvlgrthikdvaakrkielnsylqslmnastdvaecdlvctffhgshhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >2ar5A (A:)
mdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfdefqelhnklsiifpl
wklpgfpnrmvlgrthikdvaakrkielnsylqslmnastdvaecdlvctffhgshh