PDB entry 2ar3

View 2ar3 on RCSB PDB site
Description: E90A mutant structure of PlyL
Class: hydrolase
Keywords: endolysin, HYDROLASE
Deposited on 2005-08-19, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: sterne
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81WA9 (0-End)
      • engineered (89)
    Domains in SCOPe 2.07: d2ar3a1
  • Chain 'B':
    Compound: prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: sterne
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81WA9 (0-End)
      • engineered (89)
    Domains in SCOPe 2.07: d2ar3b_
  • Chain 'C':
    Compound: prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: sterne
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81WA9 (0-End)
      • engineered (89)
    Domains in SCOPe 2.07: d2ar3c_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ar3A (A:)
    meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
    qaiqgipwernawacgdgngpgnresisvaicysksggdryykaennavdvvrqlmsmyn
    ipienvrthqswsgkycphrmlaegrwgafiqkvksgnva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar3A (A:)
    meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
    qaiqgipwernawacgdgngpgnresisvaicysksggdryykaennavdvvrqlmsmyn
    ipienvrthqswsgkycphrmlaegrwgafiqkvksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ar3B (B:)
    meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
    qaiqgipwernawacgdgngpgnresisvaicysksggdryykaennavdvvrqlmsmyn
    ipienvrthqswsgkycphrmlaegrwgafiqkvksgnva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar3B (B:)
    meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
    qaiqgipwernawacgdgngpgnresisvaicysksggdryykaennavdvvrqlmsmyn
    ipienvrthqswsgkycphrmlaegrwgafiqkvksgnv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ar3C (C:)
    meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
    qaiqgipwernawacgdgngpgnresisvaicysksggdryykaennavdvvrqlmsmyn
    ipienvrthqswsgkycphrmlaegrwgafiqkvksgnva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar3C (C:)
    meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
    qaiqgipwernawacgdgngpgnresisvaicysksggdryykaennavdvvrqlmsmyn
    ipienvrthqswsgkycphrmlaegrwgafiqkvksg