PDB entry 2ar1

View 2ar1 on RCSB PDB site
Description: Structure of Hypothetical protein from Leishmania major
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, UNKNOWN FUNCTION
Deposited on 2005-08-18, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Leishmania major [TaxId:5664]
    Gene: LmjF36.6870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q067
      • see remark 999 (146)
    Domains in SCOPe 2.08: d2ar1a1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ar1A (A:)
mahhhhhhmsrkrvraedihywllksephkfsiddlakqktspwdgvrnyaarnnmrams
vgdkvlfyhsntkepgvaglaevvrlayddftaldktseyfdpkatkeknpwkmvdvkfv
arwdtvltlhelksrrelqkmalftqrrlsvqpvsaseyayilrmneeqqrk

    Sequence, based on observed residues (ATOM records): (download) 
    >2ar1A (A:)
raedihywllksephkfsiddlakqktspwdgvrnyaarnnmramsvgdkvlfyhsntke
pgvaglaevvrlayddftaldktseyfdpkatkeknpwkmvdvkfvarwdtvltlhelks
rrelqkmalftqrrlsvqpvsaseyayilrmneeqqr