PDB entry 2ar0

View 2ar0 on RCSB PDB site
Description: Crystal structure of Type I restriction enzyme EcoKI M protein (EC 2.1.1.72) (M.EcoKI)
Class: transcription,transferase
Keywords: Structural Genomics; Protein Structure Initiative; NYSGXRC; T824; Q9PNP0 Restriction modification enzyme; Type I restriction enzyme EcoKI M protein; methyltransferase, PSI, New York Structural GenomiX Research Consortium
Deposited on 2005-08-18, released 2005-08-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type I restriction enzyme EcoKI M protein
    Species: Escherichia coli
    Gene: hsdM, hsm
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08957 (Start-528)
      • modified residue (40)
      • modified residue (75)
      • modified residue (111)
      • modified residue (228)
      • modified residue (294)
      • modified residue (330)
      • modified residue (385)
      • modified residue (491)
      • modified residue (505)
    Domains in SCOP 1.75: d2ar0a1
  • Chain 'B':
    Compound: Type I restriction enzyme EcoKI M protein
    Species: Escherichia coli
    Gene: hsdM, hsm
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08957
      • modified residue (40)
      • modified residue (75)
      • modified residue (111)
      • modified residue (228)
      • modified residue (294)
      • modified residue (330)
      • modified residue (385)
      • modified residue (491)
      • modified residue (505)
    Domains in SCOP 1.75: d2ar0b1
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ar0A (A:)
    mslnnndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwdd
    lksrigqeqlqfyrkmlvhlgeddkklvqavfhnvsttitepkqitalvsnmdsldwyng
    ahgksrddfgdmyegllqknanetksgagqyftprpliktiihllkpqprevvqdpaagt
    agflieadryvksqtndlddldgdtqdfqihrafiglelvpgtrrlalmncllhdiegnl
    dhggairlgntlgsdgenlpkahivatnppfgsaagtnitrtfvhptsnkqlcfmqhiie
    tlhpggraavvvpdnvlfeggkgtdirrdlmdkchlhtilrlptgifyaqgvktnvlfft
    kgtvanpnqdknctddvwvydlrtnmpsfgkrtpftdehlqpfervygedphglsprteg
    ewsfnaeetevadseenkntdqhlatsrwrkfsrewirtaksdsldiswlkdkdsidads
    lpepdvlaaeamgelvqalseldalmrelgasdeadlqrqlleeafggvkeeggshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar0A (A:)
    ndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwddlksri
    gqeqlqfyrkmlvhlgeddkklvqavfhnvsttitepkqitalvsnmdsldwqyftprpl
    iktiihllkpqprevvqdpaagtagflieadryvksqtndlddldgdtqdfqihrafigl
    elvpgtrrlalmncllhdiegnldhggairlgntlgsdgenlpkahivatnppfgsaagt
    nitrtfvhptsnkqlcfmqhiietlhpggraavvvpdnvlfeggkgtdirrdlmdkchlh
    tilrlptgifyaqgvktnvlfftkgtvanpnqdknctddvwvydlrtnmpsfgkrtpftd
    ehlqpfervygedphglsprtegewsfnaeetevadseenkntdqhlatsrwrkfsrewi
    rtaksdsldiswlkdkdpepdvlaaeamgelvqalseldalmrelgasdeadlqrqllee
    afggv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ar0B (B:)
    mslnnndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwdd
    lksrigqeqlqfyrkmlvhlgeddkklvqavfhnvsttitepkqitalvsnmdsldwyng
    ahgksrddfgdmyegllqknanetksgagqyftprpliktiihllkpqprevvqdpaagt
    agflieadryvksqtndlddldgdtqdfqihrafiglelvpgtrrlalmncllhdiegnl
    dhggairlgntlgsdgenlpkahivatnppfgsaagtnitrtfvhptsnkqlcfmqhiie
    tlhpggraavvvpdnvlfeggkgtdirrdlmdkchlhtilrlptgifyaqgvktnvlfft
    kgtvanpnqdknctddvwvydlrtnmpsfgkrtpftdehlqpfervygedphglsprteg
    ewsfnaeetevadseenkntdqhlatsrwrkfsrewirtaksdsldiswlkdkdsidads
    lpepdvlaaeamgelvqalseldalmrelgasdeadlqrqlleeafggvkeeggshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar0B (B:)
    ndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwddlksri
    gqeqlqfyrkmlvhlgeddkklvqavfhnvsttitepkqitalvsnmdsldwqyftprpl
    iktiihllkpqprevvqdpaagtagflieadryvksqtndlddldgdtqdfqihrafigl
    elvpgtrrlalmncllhdiegnldhggairlgntlgsdgenlpkahivatnppfgsaagt
    nitrtfvhptsnkqlcfmqhiietlhpggraavvvpdnvlfeggkgtdirrdlmdkchlh
    tilrlptgifyaqgvktnvlfftkgtvanpnqdknctddvwvydlrtnmpsfgkrtpftd
    ehlqpfervygedphglsprtegewsfnaeetevadseenkntdqhlatsrwrkfsrewi
    rtaksdsldiswlkdkdpepdvlaaeamgelvqalseldalmrelgasdeadlqrqllee
    afg