PDB entry 2aqz

View 2aqz on RCSB PDB site
Description: Crystal structure of FGF-1, S17T/N18T/G19 deletion mutant
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2005-08-18, released 2006-02-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (22-23)
    Domains in SCOPe 2.04: d2aqza_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (22-23)
    Domains in SCOPe 2.04: d2aqzb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aqzA (A:)
    hhhhhhfnlppgnykkpkllycttghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqzA (A:)
    hhhhfnlppgnykkpkllycttghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyik
    stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aqzB (B:)
    hhhhhhfnlppgnykkpkllycttghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqzB (B:)
    hhhhhfnlppgnykkpkllycttghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    ckrgprthygqkailflplpv