PDB entry 2aqm

View 2aqm on RCSB PDB site
Description: CU/ZN superoxide dismutase from brucella abortus
Class: oxidoreductase
Keywords: superoxide dismutase, brucella abortus, OXIDOREDUCTASE
Deposited on 2005-08-18, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.114
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Brucella abortus [TaxId:235]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aqma_
  • Heterogens: CU1, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aqmA (A:)
    esttvkmyealptgpgkevgtvviseapgglhfkvnmekltpgyhgfhvhenpscapgek
    dgkivpalaagghydpgnthhhlgpegdghmgdlprlsanadgkvsetvvaphlkklaei
    kqrslmvhvggdnysdkpeplggggarfacgvie