PDB entry 2aqe

View 2aqe on RCSB PDB site
Description: Structural and functional analysis of ada2 alpha swirm domain
Class: transcription
Keywords: helix-turn-helix, TRANSCRIPTION
Deposited on 2005-08-17, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcriptional adaptor 2, Ada2 alpha
  Species: Mus musculus [TaxId:10090]
  Gene: Tada21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BNK0 (1-89)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d2aqea1, d2aqea2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aqeA (A:)
  gsnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrl
  aqaralikidvnktrkiydfliregyitka