PDB entry 2aqc

View 2aqc on RCSB PDB site
Description: NMR Structural analysis of archaeal Nop10
Class: RNA binding protein
Keywords: aNop10, Zinc-Ribbon, RNA BINDING PROTEIN
Deposited on 2005-08-17, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribosome biogenesis protein Nop10
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81303 (3-62)
    • cloning artifact (0-2)
  Domains in SCOPe 2.08: d2aqca1, d2aqca2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aqcA (A:)
  gshmvemrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknkn
  kae