PDB entry 2aq6

View 2aq6 on RCSB PDB site
Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution
Class: oxidoreductase
Keywords: PYRIDOXINE 5'-PHOSPHATE OXIDASE, PYRIDOXAL 5'-PHOSPHATE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2005-08-17, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxine 5'-phosphate oxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV1155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aq6a_
  • Chain 'B':
    Compound: pyridoxine 5'-phosphate oxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV1155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aq6b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aq6A (A:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq6A (A:)
    vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
    prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
    vtdrrvlltlpishvyglppgmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aq6B (B:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq6B (B:)
    vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
    prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
    vtdrrvlltlpishvyglppgmr