PDB entry 2aq3

View 2aq3 on RCSB PDB site
Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
Class: Immune system
Keywords: T-CELL RECEPTOR V BETA DOMAIN,STAPHLOCOCCAL ENTEROTOXIN C3, COMPLEX STRUCTURE, Immune system
Deposited on 2005-08-17, released 2006-03-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor beta chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3a1
  • Chain 'B':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3b1, d2aq3b2
  • Chain 'C':
    Compound: T-cell receptor beta chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3c_
  • Chain 'D':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3d1, d2aq3d2
  • Chain 'E':
    Compound: T-cell receptor beta chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3e_
  • Chain 'F':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3f1, d2aq3f2
  • Chain 'G':
    Compound: T-cell receptor beta chain V
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3g_
  • Chain 'H':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aq3h1, d2aq3h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aq3A (A:)
    ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekg
    dipdgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq3A (A:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aq3B (B:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq3B (B:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkhegnhf
    dngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyet
    gyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aq3C (C:)
    ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekg
    dipdgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq3C (C:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aq3D (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq3D (D:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsskdkvtggktcmyggitkhegnhfd
    ngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetg
    yikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aq3E (E:)
    ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekg
    dipdgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq3E (E:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2aq3F (F:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq3F (F:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdtggktcmyggitkhegnhfdn
    gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
    ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2aq3G (G:)
    ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekg
    dipdgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq3G (G:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aq3H (H:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng